PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc01162.1.g00130.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 405aa    MW: 42550.4 Da    PI: 4.7119
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc01162.1.g00130.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.98.5e-173377247
                                  SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
               Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                                   +WT+eEd+ll  av+++G ++W+ I+  ++ gR+ k+c++rw + 
  Zmw_sc01162.1.g00130.1.sm.mk 33 ASWTPEEDDLLRVAVARHGARNWTVISGAVP-GRSSKSCRLRWINQ 77
                                  58*****************************.***********985 PP

2Myb_DNA-binding56.65.8e-1884128147
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                   +g++T+eEd  l+ a+ ++G++ W+tIa+ ++ gRt++ +k++w++ 
  Zmw_sc01162.1.g00130.1.sm.mk  84 KGAFTPEEDAVLAAAHGKYGNR-WSTIAKLLP-GRTDNAIKNHWNST 128
                                   799*******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.882778IPR017930Myb domain
SuperFamilySSF466891.62E-2930125IPR009057Homeodomain-like
SMARTSM007175.7E-143180IPR001005SANT/Myb domain
PfamPF002492.6E-163377IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.0E-223483IPR009057Homeodomain-like
CDDcd001677.17E-143476No hitNo description
PROSITE profilePS5129426.10379133IPR017930Myb domain
SMARTSM007174.9E-1683131IPR001005SANT/Myb domain
PfamPF002492.2E-1584128IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-2484132IPR009057Homeodomain-like
CDDcd001672.76E-1286129No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 405 aa     Download sequence    Send to blast
MVVPGAVDDG STPRPSSSES TTTSSGAATR VRASWTPEED DLLRVAVARH GARNWTVISG  60
AVPGRSSKSC RLRWINQLSP DVEKGAFTPE EDAVLAAAHG KYGNRWSTIA KLLPGRTDNA  120
IKNHWNSTLK RQRRAAAALA GAKECDLMPP PVDDDQVVVA ATMVDVEKDE TSSTVARIPF  180
QPLVDPTEEN EDGEREEEGD DEDENGGSGE DEDSVLRLLP LPPMKRSSVV SNGGNSHLPL  240
PLLPLLEKPS EETKSPPPPP RAPQDSESVV TSLTLSLPGS DSVVPAPAAS PTPPRVTSAT  300
ATATEEERPA KARAKILEKD PRLVSVMRGM IVDEVRRHMG PVLPPPGAAA FSIMPTPAGR  360
PAPGTSSAAG GTNGPPAAAD VDQHEAKRAA VPGEPTATGT DADER
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C1e-33311323104C-Myb DNA-Binding Domain
1msf_C1e-33311323104C-Myb DNA-Binding Domain
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP4373233